Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Extract > Animal Extract >

Introduction To The Endocrine System

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    introduction to the endocrine system

    All introduction to the endocrine system wholesalers & introduction to the endocrine system manufacturers come from members. We doesn't provide introduction to the endocrine system products or service, please contact them directly and verify their companies info carefully.

    Total 706 products from introduction to the endocrine system Manufactures & Suppliers
    Wholesale Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 from china suppliers

    Brand Name:VANZ

    Model Number:Medical peptides grade

    Place of Origin:CHINA(MAINLAND)

    ...Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 Product introduction: Eptifibatide , is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class. Eptifibatide is a cyclic ...

    Wuhan Vanz Pharm Inc.
    Verified Supplier

    Hubei

    Wholesale CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin from china suppliers

    Brand Name:YIHAN

    Model Number:Nandrolone Phenylpropionate

    Place of Origin:China

    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin Nandrolone phenylpropionate Synonyms: durabolin Chemical Name: 4-estren-17beta-ol-3-one phenylpropionate CAS NO.: 62-90-8 EINECS: 200-551-9 Assay:99% Molecular Formula...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale Fulvestrant Antineoplastic ( hormonal ) Anti Estrogen Steroids White Or Almost White Powder from china suppliers

    Brand Name:Biofriend

    Model Number:129453-61-8

    Place of Origin:China

    Place of Origin: China Certification: ISO9001 CAS:129453-61-8 Molecular Fomular:C32H47F5O3S Molecular Weight:606.77 Molecular Structure: Applications: Many breast cancers are stimulated to grow by the female sex hormones oestrogen and progesterone. These ...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene from china suppliers

    Brand Name:SMQ

    Model Number:C32H36ClNO8

    Place of Origin:CHINA

    ...Self Introduction: Our company have been doing this line for more than 10 years, we are experienced ...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Pure Natural Rape Bee Pollen from china suppliers

    Place of Origin:Qinghai, China (Mainland)

    Brand Name:Super-Sweet

    Model Number:SS3001

    ...Bee Pollen Brief Introduction Pollen is the source of plant life. Bee pollen is a treasure house of natural vitamins ...

    Henan Super-Sweet Biotechnology Co., Ltd
    Verified Supplier

    Henan

    Wholesale Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish from china suppliers

    Brand Name:SSCH

    Model Number:GY-D02

    Place of Origin:GUANG DONG, CHINA

    Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish Working with principles of quantum medicine, the Quantum Magnetic Resonance Analyser detects changes in electromagnetic waves emitted by the body’s cells. By holding a sensor in the palm of ...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain from china suppliers

    Brand Name:SGH

    Model Number:86168-78-7

    Place of Origin:China

    ...-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Bodybuilding Peptides Synthetic Growth High Purity Epitalon Epithalone CAS 307297-39-8 For Muscle Building Polypeptide from china suppliers

    Brand Name:Epithalon

    Model Number:Epithalon

    Place of Origin:China

    ... Formula: C14H22N4O9 MW: 390 Sequence: Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Epitalon is a protein peptide that can stimulate the body's own natural production of telomerase within...

    Guangzhou Lishen Healthcare Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment from china suppliers

    Brand Name:XYY

    Model Number:VF10

    Place of Origin:China(mainland)

    Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment Functions: 1. Body slimming, contouring & shaping; 2. Cellulite reduction; 3. Skin Tightening; 4. Wrinkle Removal; 5. Warm Massage; 6. Face shaping and slimming. Applications ...

    Beijing Xinyingyue Beauty Equipment Science And Technology Co., Ltd.
    Verified Supplier

    Beijing

    Wholesale Vertical Water Oxygen Injection Skin Tightening and Whitening Beauty Machine from china suppliers

    Brand Name:KES

    Model Number:MED-370+

    Place of Origin:Beijing,China

    ...Oxygen Injection Skin Tightening and Whitening Beauty Machine General introduction Oxygen is indispensable to the human body's "air of health," is the energy needed for ...

    Beijing KES Biology Technology Co., Ltd.
    Verified Supplier

    Beijing

    Wholesale 650 / 808nm Diode Laser Hair Loss Therapy with LCD Screen Laser Hair Regrowth Machine from china suppliers

    Brand Name:Taibo

    Model Number:TB-650

    Place of Origin:China

    650 / 808nm Diode Laser Hair Loss Therapy with LCD Screen Laser Hair Regrowth Machine Treatment Principle Accelerate blood circulation to improve regeneration ability of collagen fibers and promote metabolism. 650nm laser and 630nm PDT can enhance the ...

    Xi'an Taibo Electronic Technology Co., Ltd.
    Verified Supplier

    Shaanxi

    Wholesale Anti Estrogen Steroids Nolvadex / Tamoxifen Citrate For Steroid Cycle Post Cycle Therapy ( PCT) 54965-24-1 from china suppliers

    Brand Name:Hongkong SaiChuang

    Model Number:Anti Estrogen Steroid

    Place of Origin:China

    Anti Estrogen Steroids Nolvadex / Tamoxifen Citrate For Steroid Cycle Post Cycle Therapy ( PCT) 54965-24-1 Tamoxifen citrate Product name: Tamoxifen citrate Synonyms: kessar; noltam; tamofen; Tamoxifen citrate : 54965-24-1 EINECS: 259-415-2 Assay: 99%-101...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Romanian Language Quantum Resonance Magnetic Analyzer Machine / Quantum Health machine from china suppliers

    Brand Name:CYM

    Model Number:K01

    Place of Origin:China

    ...Romanian Language Quantum Resonance Magnetic Analyzer Machine Quantum analyzer introduction sub-health is a middle level being health and disease, can adjust by daily life, food ...

    Guangzhou Beauty And Health Electronic Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Raw Organic Cucumber Extract Powder 30% Polysaccharide Solvent Extraction from china suppliers

    Brand Name:BIOF

    Model Number:89998-01-6

    Place of Origin:Shaanxi, China(Mainland)

    ...Water Soluble Vegetable Extract Powder Light Green Cucumber Extract Powder 30% Polysaccharide Introduction of Cucumber Extract Powder Cucumber extract has many benefits for the skin. It actually is a ...

    Xi'an Biof Bio-technology Co.,Ltd
    Verified Supplier

    Wholesale D Glucosamine Sulfate 2NaCL 38899 05 7 Anti Aging Agriculture For Healthy Food from china suppliers

    Brand Name:Health Herb

    Model Number:USP

    Place of Origin:CHINA

    ...We offer Supplement raw materials D-Glucosamine Sulfate 2NaCL Introduction Product name D-Glucosamine Sulfate 2NaCL CAS 38899-05-7 Molecular Formula (C6H14NO5)2SO4·2NaCL Molecular weight ...

    Nanjing Health Herb Bio-Tech Co., Ltd
    Verified Supplier

    Jiangsu

    Wholesale Round Shape Effervescent Vitamin Tablets Food Supplement For Improve Immunity from china suppliers

    Brand Name:OEM

    Model Number:3.5g/tablet

    Place of Origin:China

    ...Chinese Food Supplement Fruit Flavor Multi-Vitamin Effervescent Vitamin Tablets OEM Introduction: This product is with vitamin A, vitamin C, vitamin E , etc as the main raw material made of ...

    Zhengzhou Biocaro Pharmaceutical & Health-care Products Co., Ltd
    Verified Supplier

    Henan

    Wholesale Bee Propolis Final Complex Tablet Promote Metabolism Endocrine Balance BT85 from china suppliers

    Brand Name:IVC

    Model Number:BT85

    Place of Origin:Jiangsu, China

    ...Zinc 50mg+Copper 2mg Tablet promote metabolism, endocrine balance BT85 1, Supplement Facts Amount Per Tablets Calcium 210mg Bee Propolis Extract 119mg 2, Description Propolis ...

    IVC NUTRITION CORPORATION
    Active Member

    Jiangsu

    Wholesale Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones from china suppliers

    Brand Name:Baili

    Place of Origin:Jilin/China

    ...Introduction Evening primrose originates from Mexico and Central America, now grows abundantly in northeast of China. ...

    Jilin Baili Biotechnology Co.,Ltd
    Active Member

    Jilin

    Wholesale GD/A19002 Endocrine Organ Model(GD/A19002) from china suppliers

    Categories:Hyaluronic Acid Injections For Buttocks

    Telephone:86-21-55964925

    Country/Region:china

    Introduction Features: The model is mounted on a base and display endocrine gland and endocrine tissue. It consists of pituitary gland, thyroid gland, parathyroid gland, adrenal gland, pancreatic island, testicle and ovary. Material: Advanced PVC

    Shanghai Honglian medical Tech Group
    ICP Remarked Supplier

    Shanghai

    Wholesale Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit from china suppliers

    Place of Origin:China

    Brand Name:DLdevelop

    Model Number:DL-EG-VEGF-b

    ... (EG-VEGF) ELISA Kit Traditional ELISA Kit Ready-to-Use ELISA KIT Product name: Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit Method: Sandwich Synonyms: VEGF; VEGF...

    Wuxi Donglin Sci & Tech Development Co.,Ltd.
    Active Member

    Jiangsu

    Go to Page
    Inquiry Cart 0