Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home > Chemicals > Printing Inks >

Introduction To The Endocrine System

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    introduction to the endocrine system

    All introduction to the endocrine system wholesalers & introduction to the endocrine system manufacturers come from members. We doesn't provide introduction to the endocrine system products or service, please contact them directly and verify their companies info carefully.

    Total 789 products from introduction to the endocrine system Manufactures & Suppliers
    Wholesale Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 from china suppliers

    Brand Name:VANZ

    Model Number:Medical peptides grade

    Place of Origin:CHINA(MAINLAND)

    ...Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 Product introduction: Eptifibatide , is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class. Eptifibatide is a cyclic ...

    Wuhan Vanz Pharm Inc.
    Verified Supplier


    Wholesale Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​ from china suppliers

    Brand Name:SR

    Model Number:50-27-1​

    Place of Origin:China

    Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​ Product Description: Estriol belongs to natural hormone and is the metabolite of estradiol in vivo , anti estrogen steroids . It is mainly presented in the ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier


    Wholesale Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9 from china suppliers

    Brand Name:LSW

    Model Number:50-41-9

    Place of Origin:China

    Clomifene citrate / Clomid CAS: 50-41-9 Anti Estrogen Steroids GMP Factory Description: Clomifene citrate (Clomid) Another name:2-4-[2-Chloro-1,2-diphenylethenyl]phenoxy-N,N-diethylethanamine citrate Alias:serophene; pergotime; clomphid; Clomid CAS NO: 50...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier


    Wholesale Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder from china suppliers

    Brand Name:Sermorelin

    Model Number:87616-84-0

    Place of Origin:china

    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs ...

    Pharmlab Co.,Ltd
    Verified Supplier


    Wholesale Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification from china suppliers

    Brand Name:huge

    Model Number:Q41

    Place of Origin:China

    ...Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification Introduction The Quantum Magnetic Resonance Analyzer replaces the need for ultrasonic, nuclear magnetic resonance or radiography ...

    Shenzhen Huge Creation Technology Limited
    Verified Supplier


    Wholesale Injectable Anabolic Trenbolone Steroids / Trenbolone Enanthate Parabolan CAS 10161-33-8 from china suppliers

    Brand Name:kafenbiotech

    Model Number:10161-33-8

    Place of Origin:China

    ... C25H34O3 Molecular weight 382.54 Assay 99% Appearance yellow liquid Usage Hormones and Regulation of Endocrine Function of Drug Product Description: Trenbolone Enanthate, known as “Tren E” or “Tren Enanthate,”Trenbolone...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier


    Wholesale Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene from china suppliers

    Brand Name:SMQ

    Model Number:C32H36ClNO8

    Place of Origin:CHINA

    ...Self Introduction: Our company have been doing this line for more than 10 years, we are experienced ...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier


    Wholesale API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure from china suppliers

    Brand Name:Jusheng Brand

    Model Number:68-22-4

    Place of Origin:China

    API Oral Contraceptive Hormone Norethisterone For Breast Cancer Cure CAS 68-22-4 Quick detail Product Name Norethisterone Synonyms Norethisterone,98%; 17-alpha-ethynyl-17-beta-hydroxyoestr-4-en-3-one; Norethisterone; 17-ethynyl-17-hydroxyestr-4-en-3-one; ...

    Hubei Jusheng Technology Co., Ltd.
    Verified Supplier


    Wholesale CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin from china suppliers

    Brand Name:YIHAN

    Model Number:Nandrolone Phenylpropionate

    Place of Origin:China

    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin Nandrolone phenylpropionate Synonyms: durabolin Chemical Name: 4-estren-17beta-ol-3-one phenylpropionate CAS NO.: 62-90-8 EINECS: 200-551-9 Assay:99% Molecular Formula...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Wholesale CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain from china suppliers

    Brand Name:SGH

    Model Number:86168-78-7

    Place of Origin:China

    ...-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier


    Wholesale Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish from china suppliers

    Brand Name:SSCH

    Model Number:GY-D02

    Place of Origin:GUANG DONG, CHINA

    2016 Purple&Grey quantum resonance magnetic analyzer (GY-D02) Working with principles of quantum medicine, the Quantum Magnetic Resonance Analyser detects changes in electromagnetic waves emitted by the body’s cells. By holding a sensor in the palm of ...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier


    Wholesale Fatty Acid and Lung Function Quantum Body Scanning Skin Analyzer Machine from china suppliers

    Brand Name:CYM

    Model Number:K30

    Place of Origin:China

    Fatty Acid and Lung Function Quantum Body Scanning Analyzer Machine 6 report for children 1 ADHD 2 Vitamin 3 Trace element 4 Amino acids 5 Coenzyme 6 Fatty Aicd 41 report for adult 1. Cardiovascular and Cerebrovascular 2. Gastrointestinal Function 3. ...

    Guangzhou Beauty And Health Electronic Co., Ltd.
    Verified Supplier


    Wholesale Raw Organic Cucumber Extract Powder 30% Polysaccharide Solvent Extraction from china suppliers

    Brand Name:BIOF

    Model Number:89998-01-6

    Place of Origin:Shaanxi, China(Mainland)

    ...Water Soluble Vegetable Extract Powder Light Green Cucumber Extract Powder 30% Polysaccharide Introduction of Cucumber Extract Powder Cucumber extract has many benefits for the skin. It actually is a ...

    Xi'an Biof Bio-technology Co.,Ltd
    Verified Supplier

    Wholesale No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen from china suppliers

    Brand Name:Boldness

    Model Number:BL-206

    Place of Origin:China, Guangzhou

    No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen 1. 5 inch touch screen 2. Micro-current comb stimulate scalp ,massage 3. Ozone high frequency comb for hair sterilization. 4. Galanic stimulates scalp absorb the hair tonic. 5. ...

    Guangzhou Baolizi Body Beauty Equipment Factory
    Verified Supplier


    Wholesale KOSHER 2 NaCL D Glucosamine Sulfate Powder 40 Mesh Sodium Chloride White Crystal from china suppliers

    Brand Name:Health Herb

    Model Number:USP

    Place of Origin:CHINA

    ... Sodium Chloride We offer Glucosamine sulfate powder KOSHER certified 40 mesh Glucosamine Sulfate 2NaCL powder. Introduction D-Glucosamine Sulfate 2NaCl: D-Glucosamine Sulfate Sodium Chloride N-Sulfo-glucosamine sodium salt: 2-Deoxy-2-sulfoamino-D-glucose...

    Nanjing Health Herb Bio-Tech Co., Ltd
    Verified Supplier


    Wholesale Hydra Facial Skin Care Machines With Water Oxygen Jet Facial Peel System from china suppliers

    Brand Name:Sunlight

    Model Number:Sun-AVA

    Place of Origin:Beijing of China

    Beauty salon equipment hydra skin care facial machine for salon Work principle The treatment is the newest advance in non-laser skin resurfacing. it is the only hydradermabrasion equipment combining cleansing, exfoliation, extraction, hydration and ...

    Beijing Sunlight Co. Ltd.
    Verified Supplier


    Wholesale Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones from china suppliers

    Brand Name:Baili

    Place of Origin:Jilin/China

    ...Introduction Evening primrose originates from Mexico and Central America, now grows abundantly in northeast of China. ...

    Jilin Baili Biotechnology Co.,Ltd
    Active Member


    Wholesale Health Food, Wolfberry Fruit Tea, 100% Natural Wild Black Chinese Wolfberry Dried Fruit, Anticancer,Antiaging,Whitening, from china suppliers

    Brand Name:AmorBerry

    Model Number:Wild black goji berry

    Place of Origin:QINGHAI

    QingHai Qaidam Lycium ruthenicum Murray Specification: BCS certificated black wolfberry Package: 50g/bottle,100g/bottle,250g/bag, 500g/bag, 1kg/box, 10kg/box, 20kg/box Origin: Qinghai Qaidam Basin Class: No additives Notlice: must be moistureproof (...

    Ningxia Amorberry Foodstuff Co., Ltd.
    Active Member


    Wholesale GD/A19002 Endocrine Organ Model(GD/A19002) from china suppliers

    Categories:Hyaluronic Acid Injections For Buttocks



    Introduction Features: The model is mounted on a base and display endocrine gland and endocrine tissue. It consists of pituitary gland, thyroid gland, parathyroid gland, adrenal gland, pancreatic island, testicle and ovary. Material: Advanced PVC

    Shanghai Honglian medical Tech Group
    ICP Remarked Supplier


    Wholesale Rat Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit from china suppliers

    Categories:Epidermal Growth Factor



    ... stored at 4℃ Faster reaction compare to other brands 12 months shelf life Instruction Manual Introduction Item Standard Test Description The kit is a sandwich enzyme immunoassay for the in vitro quantitative...

    Wuxi Donglin Sci & Tech Development Co.,Ltd
    ICP Remarked Supplier

    Go to Page
    Inquiry Cart 0