Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Wound Dressing > Bandage >

Introduction To The Endocrine System

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    introduction to the endocrine system

    All introduction to the endocrine system wholesalers & introduction to the endocrine system manufacturers come from members. We doesn't provide introduction to the endocrine system products or service, please contact them directly and verify their companies info carefully.

    Total 744 products from introduction to the endocrine system Manufactures & Suppliers
    Wholesale Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 from china suppliers

    Brand Name:VANZ

    Model Number:Medical peptides grade

    Place of Origin:CHINA(MAINLAND)

    ...Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 Product introduction: Eptifibatide , is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class. Eptifibatide is a cyclic ...

    Wuhan Vanz Pharm Inc.
    Verified Supplier

    Hubei

    Wholesale Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit from china suppliers

    Place of Origin:China

    Brand Name:DLdevelop

    Model Number:DL-EG-VEGF-b

    ... (EG-VEGF) ELISA Kit Traditional ELISA Kit Ready-to-Use ELISA KIT Product name: Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit Method: Sandwich Synonyms: VEGF; VEGF...

    Wuxi Donglin Sci & Tech Development Co.,Ltd.
    Verified Supplier

    Jiangsu

    Wholesale CAS 129938-20-1 Golden Male Enhancement Drugs  HCL Endocrine Function Medicine from china suppliers

    Brand Name:kafenbio

    Model Number:129938-20-1

    Place of Origin:China

    ...CAS 129938-20-1 Golden Male Enhancement Drugs HCL Endocrine Function Medicine Basic Info: CAS No: 129938-20-1 MF: C21H23NO. HCl MW: 341.88 Purity: ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Boldenone Steroids Propionate White Powder For Bodybuilding Anabolic Hormone CAS 977-32-2 from china suppliers

    Brand Name:SR

    Model Number:977-32-2

    Place of Origin:China

    ....37% Appearance: White powder Usage: Pharmaceutical raw materials, the hormone Function:Hormones and Regulation of Endocrine Function of Drug, Steroid Powder for Bodybuilding Standard: Enterprise Standard. Boldenone Propionate would be more...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale Mymi Wonder slim patch weight loss fat burning body shaping for lower body or upper body from china suppliers

    Brand Name:Mymi Wonder

    Model Number:slimming patch

    Place of Origin:China

    ...Brief Introduction Applied on navel area, the effective herbal ingredients are absorbed by the rich capillary vessel ...

    Guangzhou Lishen Healthcare Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale 98% High quality Lorcaserin  HCL Lorcaserin Hydrochloride/Cas 856681-05-5 for fat loss from china suppliers

    Brand Name:Nanjian

    Model Number:98%

    Place of Origin:China

    ... Lorcaserin HCL Lorcaserin Hydrochloride/Cas 856681-05-5 for fat loss Lorcaserin Hydrochloride (Cas 856681-05-5) Introduction: Lorcaserin is a prescription medication used to help adults who are obese or who are overweight...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder from china suppliers

    Brand Name:Sermorelin

    Model Number:87616-84-0

    Place of Origin:china

    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin from china suppliers

    Brand Name:YIHAN

    Model Number:Nandrolone Phenylpropionate

    Place of Origin:China

    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin Nandrolone phenylpropionate Synonyms: durabolin Chemical Name: 4-estren-17beta-ol-3-one phenylpropionate CAS NO.: 62-90-8 EINECS: 200-551-9 Assay:99% Molecular Formula...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure from china suppliers

    Brand Name:Jusheng Brand

    Model Number:68-22-4

    Place of Origin:China

    API Oral Contraceptive Hormone Norethisterone For Breast Cancer Cure CAS 68-22-4 Quick detail Product Name Norethisterone Synonyms Norethisterone,98%; 17-alpha-ethynyl-17-beta-hydroxyoestr-4-en-3-one; Norethisterone; 17-ethynyl-17-hydroxyestr-4-en-3-one; ...

    Hubei Jusheng Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Fulvestrant Antineoplastic ( hormonal ) Anti Estrogen Steroids White Or Almost White Powder from china suppliers

    Brand Name:Biofriend

    Model Number:129453-61-8

    Place of Origin:China

    Place of Origin: China Certification: ISO9001 CAS:129453-61-8 Molecular Fomular:C32H47F5O3S Molecular Weight:606.77 Molecular Structure: Applications: Many breast cancers are stimulated to grow by the female sex hormones oestrogen and progesterone. These ...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification from china suppliers

    Brand Name:huge

    Model Number:Q41

    Place of Origin:China

    ...Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification Introduction The Quantum Magnetic Resonance Analyzer replaces the need for ultrasonic, nuclear magnetic resonance or radiography ...

    Shenzhen Huge Creation Technology Limited
    Verified Supplier

    Guangdong

    Wholesale Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene from china suppliers

    Brand Name:SMQ

    Model Number:C32H36ClNO8

    Place of Origin:CHINA

    ...Self Introduction: Our company have been doing this line for more than 10 years, we are experienced ...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9 from china suppliers

    Brand Name:LSW

    Model Number:50-41-9

    Place of Origin:China

    Clomifene citrate / Clomid CAS: 50-41-9 Anti Estrogen Steroids GMP Factory Description: Clomifene citrate (Clomid) Another name:2-4-[2-Chloro-1,2-diphenylethenyl]phenoxy-N,N-diethylethanamine citrate Alias:serophene; pergotime; clomphid; Clomid CAS NO: 50...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish from china suppliers

    Brand Name:SSCH

    Model Number:GY-D02

    Place of Origin:GUANG DONG, CHINA

    Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish Working with principles of quantum medicine, the Quantum Magnetic Resonance Analyser detects changes in electromagnetic waves emitted by the body’s cells. By holding a sensor in the palm of ...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain from china suppliers

    Brand Name:SGH

    Model Number:86168-78-7

    Place of Origin:China

    ...-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale High purity competitive price  Pharmaceutical Grade Raw Peptides Liraglutide Powder For Reduce Blood Glucose from china suppliers

    Brand Name:liraglutide

    Model Number:liraglutide

    Place of Origin:China

    Pharmaceutical Raw Materials Peptides Liraglutide Powder for reduce blood glucose CAS : 204656-20-2 Product name:Liraglutide Acetate Sequence:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(Pal-Gama-Glu)-Glu-Phe-Ile-Ala-...

    Global chemicals Co.,Ltd
    Verified Supplier

    Wholesale Energy - Saving Magnetic Knee Support Brace Pad Paste Solid No Deformation from china suppliers

    Brand Name:ALPINESNOW

    Model Number:Average size

    Place of Origin:China

    ... wear, paste solid, no deformation; intermediate layer mosaic with 8 permanent bio-magnet, can fully activate endocrine, analgesic dispelling cold, Expansion of blood vessels, to alleviate the body's local fatigue and pain...

    Hebei Zhaoyang Medical Instrum Co.,Ltd
    Verified Supplier

    Hebei

    Wholesale Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment from china suppliers

    Brand Name:XYY

    Model Number:VF10

    Place of Origin:China(mainland)

    Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment Functions: 1. Body slimming, contouring & shaping; 2. Cellulite reduction; 3. Skin Tightening; 4. Wrinkle Removal; 5. Warm Massage; 6. Face shaping and slimming. Applications ...

    Beijing Xinyingyue Beauty Equipment Science And Technology Co., Ltd.
    Verified Supplier

    Beijing

    Wholesale Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones from china suppliers

    Brand Name:Baili

    Place of Origin:Jilin/China

    ...Introduction Evening primrose originates from Mexico and Central America, now grows abundantly in northeast of China. ...

    Jilin Baili Biotechnology Co.,Ltd
    Active Member

    Jilin

    Wholesale GD/A19002 Endocrine Organ Model(GD/A19002) from china suppliers

    Categories:Hyaluronic Acid Injections For Buttocks

    Telephone:86-21-55964925

    Country/Region:china

    Introduction Features: The model is mounted on a base and display endocrine gland and endocrine tissue. It consists of pituitary gland, thyroid gland, parathyroid gland, adrenal gland, pancreatic island, testicle and ovary. Material: Advanced PVC

    Shanghai Honglian medical Tech Group
    ICP Remarked Supplier

    Shanghai

    Go to Page
    Inquiry Cart 0