Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Printing Inks >

Introduction Of Endocrine System

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    introduction of endocrine system

    All introduction of endocrine system wholesalers & introduction of endocrine system manufacturers come from members. We doesn't provide introduction of endocrine system products or service, please contact them directly and verify their companies info carefully.

    Total 798 products from introduction of endocrine system Manufactures & Suppliers
    Wholesale Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 from china suppliers

    Brand Name:VANZ

    Model Number:Medical peptides grade

    Place of Origin:CHINA(MAINLAND)

    ...Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 Product introduction: Eptifibatide , is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class. Eptifibatide is a cyclic ...

    Wuhan Vanz Pharm Inc.
    Verified Supplier

    Hubei

    Wholesale Anti Estrogen Steroids Nolvadex / Tamoxifen Citrate For Steroid Cycle Post Cycle Therapy ( PCT) 54965-24-1 from china suppliers

    Brand Name:Hongkong SaiChuang

    Model Number:Anti Estrogen Steroid

    Place of Origin:China

    Anti Estrogen Steroids Nolvadex / Tamoxifen Citrate For Steroid Cycle Post Cycle Therapy ( PCT) 54965-24-1 Tamoxifen citrate Product name: Tamoxifen citrate Synonyms: kessar; noltam; tamofen; Tamoxifen citrate : 54965-24-1 EINECS: 259-415-2 Assay: 99%-101...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale 2019 Newest Vector V16 NLS  Software Bioresonance Diagnostics And Therapy bioresonance machine biofeedback from china suppliers

    Brand Name:SSCH

    Model Number:GY-V16

    Place of Origin:China

    ...) system. 2. Computer should connect the internet once a month. 3. Software can not install on different computer. Introduction: Bio-Resonance Feedback Therapy (META-Therapy) is a frontier technology based on quantum physics. Bio-Resonance...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale safe Estradiol Enanthate Estrogen Steroids Hormone Raw Steroid Powders from china suppliers

    Brand Name:SMQ

    Model Number:C25H36O3

    Place of Origin:CHINA

    ...Self Introduction: Our company have been doing this line for more than 10 years, we are experienced ...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9 from china suppliers

    Brand Name:LSW

    Model Number:50-41-9

    Place of Origin:China

    Clomifene citrate / Clomid CAS: 50-41-9 Anti Estrogen Steroids GMP Factory Description: Clomifene citrate (Clomid) Another name:2-4-[2-Chloro-1,2-diphenylethenyl]phenoxy-N,N-diethylethanamine citrate Alias:serophene; pergotime; clomphid; Clomid CAS NO: 50...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder from china suppliers

    Brand Name:Sermorelin

    Model Number:87616-84-0

    Place of Origin:china

    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification from china suppliers

    Brand Name:huge

    Model Number:Q41

    Place of Origin:China

    ...Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification Introduction The Quantum Magnetic Resonance Analyzer replaces the need for ultrasonic, nuclear magnetic resonance or radiography ...

    Shenzhen Huge Creation Technology Limited
    Verified Supplier

    Guangdong

    Wholesale Injectable Anabolic Trenbolone Steroids / Trenbolone Enanthate Parabolan CAS 10161-33-8 from china suppliers

    Brand Name:kafenbiotech

    Model Number:10161-33-8

    Place of Origin:China

    ... C25H34O3 Molecular weight 382.54 Assay 99% Appearance yellow liquid Usage Hormones and Regulation of Endocrine Function of Drug Product Description: Trenbolone Enanthate, known as “Tren E” or “Tren Enanthate,”Trenbolone...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​ from china suppliers

    Brand Name:SR

    Model Number:50-27-1​

    Place of Origin:China

    Estriol Anti Estrogen Steroids Raw Pharmaceutical Active Ingredients 99.9% Purity Cas 50-27-1​ Product Description: Estriol belongs to natural hormone and is the metabolite of estradiol in vivo , anti estrogen steroids . It is mainly presented in the ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure from china suppliers

    Brand Name:Jusheng Brand

    Model Number:68-22-4

    Place of Origin:China

    API Oral Contraceptive Hormone Norethisterone For Breast Cancer Cure CAS 68-22-4 Quick detail Product Name Norethisterone Synonyms Norethisterone,98%; 17-alpha-ethynyl-17-beta-hydroxyoestr-4-en-3-one; Norethisterone; 17-ethynyl-17-hydroxyestr-4-en-3-one; ...

    Hubei Jusheng Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin from china suppliers

    Brand Name:YIHAN

    Model Number:Nandrolone Phenylpropionate

    Place of Origin:China

    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin Nandrolone phenylpropionate Synonyms: durabolin Chemical Name: 4-estren-17beta-ol-3-one phenylpropionate CAS NO.: 62-90-8 EINECS: 200-551-9 Assay:99% Molecular Formula...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain from china suppliers

    Brand Name:SGH

    Model Number:86168-78-7

    Place of Origin:China

    ...-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Fatty Acid and Lung Function Quantum Body Scanning Skin Analyzer Machine from china suppliers

    Brand Name:CYM

    Model Number:K30

    Place of Origin:China

    Fatty Acid and Lung Function Quantum Body Scanning Analyzer Machine 6 report for children 1 ADHD 2 Vitamin 3 Trace element 4 Amino acids 5 Coenzyme 6 Fatty Aicd 41 report for adult 1. Cardiovascular and Cerebrovascular 2. Gastrointestinal Function 3. ...

    Guangzhou Beauty And Health Electronic Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Raw Organic Cucumber Extract Powder 30% Polysaccharide Solvent Extraction from china suppliers

    Brand Name:BIOF

    Model Number:89998-01-6

    Place of Origin:Shaanxi, China(Mainland)

    ...Water Soluble Vegetable Extract Powder Light Green Cucumber Extract Powder 30% Polysaccharide Introduction of Cucumber Extract Powder Cucumber extract has many benefits for the skin. It actually is a ...

    Xi'an Biof Bio-technology Co.,Ltd
    Verified Supplier

    Wholesale No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen from china suppliers

    Brand Name:Boldness

    Model Number:BL-206

    Place of Origin:China, Guangzhou

    No Pain Professional Galvanic Hair Regrowth Treatment Machine Touch Screen 1. 5 inch touch screen 2. Micro-current comb stimulate scalp ,massage 3. Ozone high frequency comb for hair sterilization. 4. Galanic stimulates scalp absorb the hair tonic. 5. ...

    Guangzhou Baolizi Body Beauty Equipment Factory
    Verified Supplier

    Guangdong

    Wholesale KOSHER 2 NaCL D Glucosamine Sulfate Powder 40 Mesh Sodium Chloride White Crystal from china suppliers

    Brand Name:Health Herb

    Model Number:USP

    Place of Origin:CHINA

    ... Sodium Chloride We offer Glucosamine sulfate powder KOSHER certified 40 mesh Glucosamine Sulfate 2NaCL powder. Introduction D-Glucosamine Sulfate 2NaCl: D-Glucosamine Sulfate Sodium Chloride N-Sulfo-glucosamine sodium salt: 2-Deoxy-2-sulfoamino-D-glucose...

    Nanjing Health Herb Bio-Tech Co., Ltd
    Verified Supplier

    Jiangsu

    Wholesale Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones from china suppliers

    Brand Name:Baili

    Place of Origin:Jilin/China

    ...Introduction Evening primrose originates from Mexico and Central America, now grows abundantly in northeast of China. ...

    Jilin Baili Biotechnology Co.,Ltd
    Active Member

    Jilin

    Wholesale Health Food, Wolfberry Fruit Tea, 100% Natural Wild Black Chinese Wolfberry Dried Fruit, Anticancer,Antiaging,Whitening, from china suppliers

    Brand Name:AmorBerry

    Model Number:Wild black goji berry

    Place of Origin:QINGHAI

    QingHai Qaidam Lycium ruthenicum Murray Specification: BCS certificated black wolfberry Package: 50g/bottle,100g/bottle,250g/bag, 500g/bag, 1kg/box, 10kg/box, 20kg/box Origin: Qinghai Qaidam Basin Class: No additives Notlice: must be moistureproof (...

    Ningxia Amorberry Foodstuff Co., Ltd.
    Active Member

    Ningxia

    Wholesale GD/A19002 Endocrine Organ Model(GD/A19002) from china suppliers

    Categories:Hyaluronic Acid Injections For Buttocks

    Telephone:86-21-55964925

    Country/Region:china

    Introduction Features: The model is mounted on a base and display endocrine gland and endocrine tissue. It consists of pituitary gland, thyroid gland, parathyroid gland, adrenal gland, pancreatic island, testicle and ovary. Material: Advanced PVC

    Shanghai Honglian medical Tech Group
    ICP Remarked Supplier

    Shanghai

    Wholesale Rat Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit from china suppliers

    Categories:Epidermal Growth Factor

    Telephone:+86-510-82732223,778-477-6628

    Country/Region:china

    ... stored at 4℃ Faster reaction compare to other brands 12 months shelf life Instruction Manual Introduction Item Standard Test Description The kit is a sandwich enzyme immunoassay for the in vitro quantitative...

    Wuxi Donglin Sci & Tech Development Co.,Ltd
    ICP Remarked Supplier

    Go to Page
    Inquiry Cart 0