Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Paint & Coatings >

Human Growth Hormone Diet

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    human growth hormone diet

    All human growth hormone diet wholesalers & human growth hormone diet manufacturers come from members. We doesn't provide human growth hormone diet products or service, please contact them directly and verify their companies info carefully.

    Total 1180 products from human growth hormone diet Manufactures & Suppliers
    Wholesale Kigtropin Human Growth Hormone Peptide 20iu 10iu 191AA Grade SGS Approved For Anting Aging from china suppliers

    Brand Name:Bodybiological

    Model Number:Kigtropin HGH

    Place of Origin:Hubei, China

    ...191AA Grade SGS Approved Kigtropin HGH Hormone 20iu 10iu for Anting-Aging About Kigtropin Kigtropin is a Human Growth Hormone (hGH) Somatropin produced with recombinant DNA technology identical to the body naturally produced HGH Kigtropin...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale 863288-34-0 Human Growth Hormone Peptide Cjc-1295 Without Dac Anabolic Peptide For Fat Burning from china suppliers

    Brand Name:Pharmlab

    Model Number:863288-34-0

    Place of Origin:China

    ...Human Growth Hormone Peptide Cjc-1295 Without Dac Anabolic Peptide For Fat Burning Basic Info Name: CJC-1295 (...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale White Lyophilized Human Growth Hormone Injections 98.5% Purity from china suppliers

    Brand Name:Jiacheng

    Model Number:Human Growth Hormone

    Place of Origin:China

    ...White Lyophilized Human Growth Hormone Injections 98.5% Purity Quick Detail: Brand Name: human growth hormones Place of Origin: China Purity : 98.5% Color : white Lyophilized powder Standard: 10iu/vial, 100iu/box ...

    Zhuhai jiacheng Sci. & Tech. Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Human Growth Hormone Peptide HGH Fragment 176-191(2mg/5mg) CAS.221231-10-3 from china suppliers

    Brand Name:TY - CHEMICAL

    Model Number:221231-10-3

    Place of Origin:china

    ...Human Growth Hormone Peptide HGH Fragment 176-191(2mg/5mg) CAS.221231-10-3 HGH Fragment 176-191 safely passes customs, high quality & high purity hormone peptides. >>>>>Quick Detail: Synonyms: Fragment 177-191, AOD-9604...

    Guangzhou Teng yue Chemical Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Injectable 100iu HGH Human Growth Hormone Steroid Ansomone For Burning from china suppliers

    Brand Name:RX

    Model Number:589

    Place of Origin:China

    ...Injectable 100iu HGH Human Growth Hormone Steroid Ansomone For Burning Ansomone Posted under: HGH (Human Growth Hormone) Ansomone – a popular high-quality drug, which main active substance is recombinant growth hormone (rHGH), the structure of which is ...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Injectable HGH Human Growth Hormone For Weight Loss Melanotan 2 Cool Dry Storage from china suppliers

    Brand Name:Diselbiotech

    Model Number:MT2

    Place of Origin:China

    ... improve the aerobic metabolism of the muscle and greatly enhance muscle strength and endurance from diet alone. 3. It can be used as

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale GMP Standard Peptides Powder Human Growth Hormone Peptide 10MG MT2 Melanotan2 For Skin Tanning from china suppliers

    Brand Name:YIHAN

    Model Number:121062-08-6

    Place of Origin:CHINA

    GMP factory Peptides Powder 10MG MT2 melanotan2 for skin tanning Introduction Name: Melanotan II Acetate (MT-II) CAS No.: 121062-08-6 Molecular Formula: C50H71N15O10 Molecular Weight: 1042.1932 Property: White powder Assay: 99% Packing: As your request ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Wholesale High Purity Fat Loss Human Growth Hormone Peptide HGH 176-191 Fragment (221231-10-3) 2mg per vial For Fat Burning from china suppliers

    Brand Name:YIHAN

    Model Number:HGH 176-191

    Place of Origin:China

    ...Fat Loss Human Growth Hormone Peptide HGH 176-191 Fragment 2mg per vial 1.Quick Detail: HGH fragment 176-191 Synonyms: ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale CJC-1295 DAC Human Growth Hormone Peptide Polypeptide For Protein Growth / Muscle Building from china suppliers

    Brand Name:LSW

    Model Number:CJC-1295 with DAC

    Place of Origin:China

    ...CJC-1295 with DAC Human Growth Hormone Polypeptide 2mg/vial for Protein Growth and Muscle Building CJC Peptide Profile: CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH). Invented by a Canadian ...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Ghrp 6 HGH Human Growth Hormone 99% Purity Peptide Acetate For Bodybuilding from china suppliers

    Model Number:GHRP-6

    ...GHRP-6 99% Purity HGH Human Growth Hormone Peptide Acetate For Bodybuilding​ Detailed Product Description Appearance: Powder Purity: 99.9% Production Capacity: 1000kg/month ...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier

    Hubei

    Wholesale Peptide Powder Hgh Human Growth Hormone Ghrp -6 10mg/ Vial For Muscle Growth from china suppliers

    Brand Name:Global Chemical

    Model Number:GHRP-2

    Place of Origin:China

    Basic Info Packing: Disguised Package or as Required Markets: Global Transport Package: Disguised Package or as Required Suitable for: Adult Purity: >98% Other Name: Ghrp-6 Acetate Function: for Weight Loss Storage: Keep Cold Form: White Frozen Dry Powder...

    Global chemicals Co.,Ltd
    Verified Supplier

    Wholesale GHRP-6 Raw Human Growth Hormone GHRP-6 CAS 87616-84-0 Peptides from china suppliers

    Brand Name:Yuancheng

    Model Number:87616-84-0

    Place of Origin:Wuhan,Hubei

    ...GHRP-6 Raw Human Growth Hormone GHRP-6 CAS 87616-84-0 Peptides Product Name: GHRP-6 Acetate Cas No. : 87616-84-0 Molecular Formula: ...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale Real Somatropin R-HGH Human Growth Hormone 191AA HGH 10iu Blue Caps No label from china suppliers

    Brand Name:HongxiPharm

    Model Number:Somatropin / HGH 10iu/vial

    Place of Origin:CHINA

    ...Somatropin (Human Growth Hormone) R-HGH Product Name Somatropin Also known as 191AA HGH, Human Growth Hormone, R-HGH Appearance Sterile Filtered White lyophilized (freeze-dried) powder Standard Pharmaceutical / Research Use Packing 10iu / ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier

    Hongkong

    Wholesale White Ghrp-2 Human Growth Hormone For Bodybuilding , CAS 158861-67-7 from china suppliers

    Brand Name:Kafen

    Model Number:158861-67-7

    Place of Origin:China

    ...Sell White Ghrp-2 Human Growth Hormone For Bodybuilding CAS:158861-67-7 Basic Info: Product name: GHRP-2 (GHRP-2 Acetate ) Synonym: Pralmorelin [INN]; D-...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale 99% Purity HCG 5000iu CAS9002-61-3  Human Growth Hormone Peptide from china suppliers

    Brand Name:Top Pharm

    Model Number:9002-61-3

    Place of Origin:China

    ... vials Packing Freeze-dried powder in 10ml vials What is human chorionic gonadotropin (hCG)? During pregnancy, cells in the developing placenta make human chorionic gonadotropin, or hCG. The placenta is the sac...

    TOP PHARM CO.,LIMITED
    Verified Supplier

    Wholesale Pharma Grade Human Generic Growth Hormone China Blue Cap 99.7% Purity HGH from china suppliers

    Brand Name:HKBL

    Model Number:HGH hygeteropin

    Place of Origin:China

    ...Pharma Grade Human Generic Growth Hormone China Blue Cap 99.7% Purity HGH 1. HGH is protected from the inappropriate storage conditions. Hygetropin ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale Natural Riptropin Human Growth Hormone Steroids 10 IU Real HGH Injections from china suppliers

    Brand Name:Riptropin

    Model Number:10 IU/vial

    Place of Origin:China

    ...Natural Riptropin Human Growth Hormone Steroids 10 IU Real HGH Injections Riptropin [rDNA origin] is a way to supply natural growth human growth hormone for people who may deficient or may require higher levels of this hormone. Riptropin is...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Wholesale Freeze Dried Powder HGH Somatropin Human Growth Hormone for muscle growth from china suppliers

    Brand Name:Kigtropin

    Model Number:10iu/vial, 100iu/box

    Place of Origin:China

    ... alpha 2b for injection Trade name: Kigtropin Composition in effect: Recombinant Human Interferon alpha 2b. Anti-Aging Kigtropin 100iu Human Somatropin For Muscle Increase Description: White Lyophilized powder.Before administration, add 1ml...

    HongKong Amgen Biopharm CO.,LTD
    Active Member

    Hong Kong

    Wholesale Protein Peptide Hormones CJC-1295DAC Powder Polypeptide Materials Human Growth Hormone from china suppliers

    Brand Name:Muscle Man

    Model Number:Cas No:863288-34-0

    Place of Origin:Hunan,China

    ...Protein Peptide Hormones CJC-1295DAC Powder Polypeptide Materials Human Growth Hormone Quick Detail: Alias: CJC-1295 Acetate; CJC1295 DAC; CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Site Member

    Hunan

    Go to Page
    Inquiry Cart 0