Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Paint & Coatings >

Hcg Hormone Diet

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    hcg hormone diet

    All hcg hormone diet wholesalers & hcg hormone diet manufacturers come from members. We doesn't provide hcg hormone diet products or service, please contact them directly and verify their companies info carefully.

    Total 272 products from hcg hormone diet Manufactures & Suppliers
    Wholesale Kigtropin Human Growth Hormone Peptide 20iu 10iu 191AA Grade SGS Approved For Anting Aging from china suppliers

    Brand Name:Bodybiological

    Model Number:Kigtropin HGH

    Place of Origin:Hubei, China

    ...191AA Grade SGS Approved Kigtropin HGH Hormone 20iu 10iu for Anting-Aging About Kigtropin Kigtropin is a Human Growth Hormone (hGH) Somatropin produced with recombinant DNA technology identical to the body naturally produced...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale HGH HCG Health Growth Hormone Human Chorionic Gonadotropin 99.9% Purity from china suppliers

    Model Number:HCG

    Place of Origin:china

    ...HGH HCG Health Growth Hormone Human Chorionic Gonadotropin 99.9% Purity Whatsapp:+8613165394499 Email:jerryrcchem@gmail.com superiority: safty,effective and ...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier

    Hubei

    Wholesale Injectable 100iu HGH Human Growth Hormone Steroid Ansomone For Burning from china suppliers

    Brand Name:RX

    Model Number:589

    Place of Origin:China

    ... 100iu HGH Human Growth Hormone Steroid Ansomone For Burning Ansomone Posted under: HGH (Human Growth Hormone) Ansomone – a popular high-quality drug, which main active substance is recombinant growth hormone (rHGH), the structure of...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Testosterone Cypionate Test Cyp CAS 58-20-8 Testosterone Steroid Hormone Drugs from china suppliers

    Brand Name:SR

    Model Number:58-20-8

    Place of Origin:China

    ...Test Cypionate Testosterone Cypionate Test Cyp CAS 58-20-8 Testosterone Steroid Hormone Drugs Product Description: Product name: Testosterone cypionate Synonyms: cyponax CAS No.: 58-20-8 M.F.: C27H40O3 M.W.: 412.6 ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale 96827-07-5 Human Growth Hormone Injections For Bone Density Increase from china suppliers

    Brand Name:Jiacheng

    Model Number:Human Growth Hormone

    Place of Origin:China

    ... Trade name: Hygetropoin Composition in effect: Recombinant Human Interferon alpha 2b Brand Name: human growth hormones Place of Origin: China Purity : 99% ? Color : white Lyophilized powder Standard: GMP Product Details: Kigtropin...

    Zhuhai jiacheng Sci. & Tech. Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping from china suppliers

    Brand Name:KA-XING

    Model Number:315-37-7

    Place of Origin:Guangdong ,China

    CJC-1295 without DAC from Peptides 1.Quick Detail: Product Name: CJC-1295 English name: CJC-1295 (without DAC) CAS number: 863288-34-0 Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular formula: C152H252N44O42 ...

    Zhuhai Jiacheng Bio-Tech Co., Ltd.
    Verified Supplier

    Macau

    Wholesale Health HGH Human Growth Hormone Drugs Muscle Gain / Mens Hgh Supplements from china suppliers

    Brand Name:Diselbiotech

    Model Number:Fragment 176 191

    Place of Origin:China

    ... of GH appear to be controlled by a small region near one end of the Growth Hormone molecule. This region consisting of amino acids 176-191, is less than

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale 99% Purity HCG 5000iu CAS9002-61-3  Human Growth Hormone Peptide from china suppliers

    Brand Name:Top Pharm

    Model Number:9002-61-3

    Place of Origin:China

    ... powder in 10ml vials What is human chorionic gonadotropin (hCG)? During pregnancy, cells in the developing placenta make human chorionic gonadotropin, or hCG. The placenta is the sac that nourishes the egg...

    TOP PHARM CO.,LIMITED
    Verified Supplier

    Wholesale Legal Oral Testosterone Steroid Hormone Testosterone Enanthate For Muscle Building from china suppliers

    Brand Name:HAIWEN

    Model Number:315-37-7 Testosterone Steroid Hormone Testosterone Enanthate

    Place of Origin:shenzhen,China

    ...Legal Oral Testosterone Steroid Hormone Testosterone Enanthate For Muscle Building General Information: Drug name: Testosterone Enanthate Drug class: Anabolic / androgenic ...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Powerful Polypeptide Hormone 5000iu / Via Human Chorionic Gonadotropin Hormone from china suppliers

    Brand Name:Landmark

    Place of Origin:China

    Model Number:Pharma grade

    ...Powerful Polypeptide Hormone 5000iu / via Human Chorionic Gonadotropin (HCG) The whole name of HCG is Human Chorionic Gonadotropin which is a Powerful Polypeptide Hormone. It plays different roles between male and female. For Women, HCG affects...

    Landmark Nutraceuticals Co., Limited
    Verified Supplier

    Hongkong

    Wholesale High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Adult Natural Human Growth Hormone HGH Pen For Body Building 5 Vials / K from china suppliers

    Brand Name:YIHAN

    Model Number:12629-01-5

    Place of Origin:China

    ...Wholesale Price bodybuilding Somatropin Cartridges Somatropin injection Human Growth Hormone HGH pen 36iu/vial,5 vials/k Human Growth Hormone Peptide 16iu Water Base of HGH Pen 16iu/vial,5 vials/kitfor Easier Injection Quick...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Wholesale White lyophilized powder Human Growth Hormone HGH 191AA 10iu 15iu Steroids for Muscle Building from china suppliers

    Brand Name:YIHAN

    Model Number:hgh 191aa

    Place of Origin:China

    ...Hot selling HGH Human Growth Hormone 10iu 15iu per vial Powder Quick Detail: Product Name HGH CAS NO CAS106505-90-2 Apperance ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale Hormone Steroid Powder Testosterone Cypionate / Test Cyp For Bodybuilding  58-20-8 from china suppliers

    Brand Name:saichuang

    Model Number:steroid hormone raw powder

    Place of Origin:Hubei, China

    ... I will give info.in details. kathelin@yccreate.com Skype:live:kathelin_4 WhataApp:+8618872220706 Now Testosterone Hormonal Substitute- Available Everywhere Effortlessly Testosterone Cypionate(Test Cyp) Description: Testosterone cypionate is a

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale SARM Raw Powder Positive Oral Growth Hormone MK-677/MK677 Ibutamoren For Bulking Cycles from china suppliers

    Brand Name:Yuancheng

    Model Number:159752-10-0

    Place of Origin:Wuhan,Hubei

    ....5% MK677 Introduction: MK677 is a drug which falls somewhere between two separate groups of drugs, growth hormone secretagogues (GSH) and selective androgen receptor modulators (SARMs). Human studies have shown MK677 to increase

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale 99% Purity Anabolic Steroid Hormones Oxandrolone  Anavar for Muscel building from china suppliers

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    CAS 53-39-4 Oxandrolone Product Name:Oxandrolone,Anavar Alias: Oxandrin,Lonavar, Xtendrol CAS Registry Number:53-39-4 EINECS: 200-172-9 Assay: 99% min. Grade : Pharmaceutical Grade Molecular Formula: C19H30O3 Molecular weight: 306.4 MP: 215.3-226.3°C ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale Effective Hormone Sarms Raw Powder MK-677 (Ibutamoren) 159634-47-6 for Weight Loss from china suppliers

    Brand Name:Pharmlab

    Model Number:159634-47-6

    Place of Origin:China

    ... 99% Grade Pharmaceutical Grade Appearance White Powder Introduction : The drug stimulates the production of growth hormone (somatotropin), which occurs due to chemical signals sent to the pituitary gland. MK-677 also...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale hcg wholesale,hcg hormone,hcg buy,china hcg from china suppliers

    Place of Origin:China

    Brand Name:HCG

    Model Number:HCG-02

    ...Inquiry and order email: hghseller at hotmail.com Product name: HCG HGH Price: 35-60$/kit(order more, better price) MOQ: 1 KIT Specification: 25000iu/kit (5000iu/...

    Super Human Growth Hormone Pharmaceutical Co.,Ltd
    Active Member

    Guangdong

    Wholesale 9002-61-3 HCG Injection 5000 IU Muscle Growth Hormone For Bodybuilding from china suppliers

    Brand Name:LIVZON

    Model Number:5000 IU/vial

    Place of Origin:China

    ... water inside, 10 vials/kit Human chorionic gonadotropin (American English) or Human chorionic gonadotrophin (hCG) is a glycoprotein hormone produced in pregnancy that is made by the developing embryo soon after conception and...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Wholesale Riptropin HGH Human Growth Hormone High Quality HGH Wholesale 100% Original From Factory from china suppliers

    Place of Origin:Shen Zhen of China

    Brand Name:Riptropin

    Model Number:HGH-25

    Riptropin HGH Introduction The effects about HGH are tremendous: (1)HGH promotes and increases the synthesis of new protein tissues, such as in muscle recovery or repair,build new muscle. (2)Recent research suggests its involvement in the metabolism of ...

    Hongkong HW Biotech Co.,Ltd.
    Site Member

    Yunnan

    Go to Page
    Inquiry Cart 0