Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    fast acting insulins

    All fast acting insulins wholesalers & fast acting insulins manufacturers come from members. We doesn't provide fast acting insulins products or service, please contact them directly and verify their companies info carefully.

    Total 27 products from fast acting insulins Manufactures & Suppliers
    Wholesale High Purity Weight Loss Adipotide Peptide Medicine Grade GMP Certification from china suppliers

    Brand Name:Filter

    Place of Origin:Shanghai

    High Purity Adipotide Peptide for Weight Loss Description Adipotide, a peptidomimetic with sequence CKGGRAKDC-GG-D(KLAKLAK)2, is an experimental proapoptotic drug that has been shown to cause rapid weight loss in mice and rhesus monkeys. Its mechanism of ...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Wholesale 99% Purity MK-677 Sarms Raw Powder White Color Pharmaceutical Grade from china suppliers

    Brand Name:Sai chuang

    Model Number:159634-47-6

    Place of Origin:China

    ...: Ibutamoren (developmental code names MK-677, MK-0677, L-163,191) is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor and a growth hormone

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale Injection Jintropin 10 Iu HGH Growth Hormone Body Building High Purity Peptide from china suppliers

    Brand Name:FILTER

    Model Number:API

    Place of Origin:China

    Injection Jintropin 10iu for Muscle Building with GMP From Lab (OEM) Product Name:Genotropin (OEM) Specification:10IU,16IU,27IU,36IU Packing:We are for OEM for clients who have Brands requiremtnts. Our company Specialize in Peptides and Steriods.We have ...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Wholesale Fragment 176-191 Bodybuilding Peptides , Lab Research Pharmaceutical Intermediate from china suppliers

    Brand Name:FILTER

    Model Number:API

    Place of Origin:China

    ... No.: 221231-10-3 Other Names: Fragment 177-191 MF: C78H123N23O23S2 EINECS No.: N/A Place of Origin: SHANGHAI, China (Mainland) Type: Immune Function Agents Grade Standard: Medicine Grade Usage: Animal Pharmaceuticals Brand Name...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Wholesale Chinese high purity Agmatine sulfate white crystalline powder CAS No.: 2482-00-0 from china suppliers

    Place of Origin:China

    Brand Name:Taigui

    Model Number:CAS No.: 2482-00-0

    Agmatine sulfate Product Name: (4-Aminobutyl)guanidinium sulphate 1-Amino-4-guanidinobutane sulfate salt CAS No.: 2482-00-0 MF:C5H14N4 H2SO4C5H16N4O4S EINECS No.: 219-617-3 Molecular Formula: Assay:98% Min Appearance: white crystalline powder Grade ...

    Shanghai Taigui Pharmaceutical Technology Co., Ltd
    Site Member

    Shanghai

    Wholesale Injectable Anabolic Steroids Raw Testosterone Powder Suspension Anabolic Hormone from china suppliers

    Brand Name:YIJING

    Model Number:58-22-0

    Place of Origin:SHANGHAI

    Injectable Anabolic Steroids Raw Testosterone Powder Suspension Anabolic Hormone Quick Details: Product name: Testosterone suspension Specification: 100mg/ml Substance: Testosterone base Testosterone base CAS: 58-22-0 Testosterone MF: C19H28O2 ...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Wholesale Testosterone suspension cas:5949-44-0 Injectable Anabolic Steroids 99% 100mg/ml For Bodybuilding from china suppliers

    Brand Name:SHUCAN

    Model Number:58-22-0

    Place of Origin:SHANGHAI

    ... a reputation of being an extremely potent injectable, often ranked highest among the testosterones. Being very fast acting, testosterone

    ShangHai ShuCan Industrial Co,LTD
    Active Member

    Wholesale In 2016, Hot seller Testosterone suspension CAS 58-22-0 Injectable Anabolic Steroids for Bodybui with 100mg/ml from china suppliers

    Brand Name:JBY

    Model Number:Testosterone suspension

    Place of Origin:China

    In 2016, Hot seller Testosterone suspension CAS 58-22-0 Injectable Anabolic Steroids for Bodybui with 100mg/ml Product name: Testosterone suspension Specification: 100mg/ml Substance: Testosterone base Testosterone base CAS: 58-22-0 Testosterone MF: ...

    WuHan ShuCan Co., LTD.
    Active Member

    Wholesale 99% Purity HGH fragment 176-191 CAS 221231-10-3 No Side Effect Fat-loss peptide from china suppliers

    Brand Name:ShuCan

    Model Number:99%

    Place of Origin:China

    HGH fragment 176-191 (2mg/vial) Suitable for: Adult State: Liquid or Powder Appearance: White Crystalline Powder or Oil Payment: Western Union, Moneygram, T/T,Bitcion Delivery: 3-5 Days 100%Door to Door Polciy: Re-Shipping Policy Shipment: EMS, FedEx, TNT...

    Shanghai Shu Can Industrial Co.,Ltd.
    Active Member

    Wholesale Anti - Inflammatory Organic Food Ingredients Ground Flaxseed Powder Halal Approval from china suppliers

    Brand Name:MicroFresh

    Model Number:Powder

    Place of Origin:China

    Flax Seed(Powder/Extract);Freeze- Dried; antioxidant factors; Organic Food Ingredients, Natural origin Flax (Linum usitatissimum), also known as common flax or linseed, is a member of the genus Linum in the family Linaceae. It is a food and fiber crop ...

    ECA Healthcare Inc
    Active Member

    Shanghai

    Wholesale High Purity 99% Lyophilized Bodybuilding Polypeptide Hormones PEG-MGF Mechano Growth Factor 2mg from china suppliers

    Brand Name:yijing

    Model Number:gclb5t@yccreate.com

    Place of Origin:china

    Excellent quality Pharmaceutical raw material 99% Procaine Hydrochloride Procaine HCl CAS 51-05-8 for Local Anesthetic Pharmaceutical Raw Materials Polypeptide PEG-MGF Promote Growth Factor Bodybuilding Product introduction: PEG-MGF ; MGF; MGF,PEG-MGF,peg...

    ShangHai YiJing Industrial Co,LTD
    Active Member

    Wholesale Golden Quality GHRP-6 (GHRP-6 Acetate) CAS :87616-84-0  For Bodybuilding!!! from china suppliers

    Brand Name:Yi Jing

    Model Number:mxy0305@ycphar.com

    Place of Origin:China mxy0305

    Golden Quality GHRP-6 (GHRP-6 Acetate) CAS :87616-84-0 For Bodybuilding!!! GHRP-6 GHRP-6 Alias: GHRP-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 GHRP-6 Unit Size: 5 mg/vial GHRP-6 Unit Quantity: 1 Vial GHRP-6 ...

    Shanghai Yi Jing Industrial Co.,Ltd.
    Active Member

    Shanghai

    Wholesale HGH fragment 176-191 (2mg/vial) 221231-10-3 Fat-loss Peptide AOD-9604 from china suppliers

    Brand Name:Shu Can

    Model Number:99%

    Place of Origin:China

    ...-3 Appearance: White Powder Purity: 98% Grade: Pharmaceutical Grade Storage: Closed, below 2 ~ 8 C preservation Usage: AOD9604 actually acts on the reduction of excessive adipose tissues such as increase in muscle mass, and enhances...

    Shanghai YiJing Industrial Co.,Ltd.
    Active Member

    Shanghai

    Wholesale La Fenice Insulin Pump from china suppliers

    Categories:Insulin Pump

    Telephone:+86-21-64830519

    Country/Region:china

    .... It delivers fast-acting insulin from a reservoir inside the pump to the body through a tiny plastic tube, called an infusion set. Pump therapy more closely mimics the insulin delivery of a healthy pancreas. Unlike insulin shots...

    Shanghai KeLy Bio-Pharmaceutical Co., Ltd.
    ICP Remarked Supplier

    Shanghai

    Wholesale Anabolic Steroid Hormones Epinephrine Hydrogen Tartrate CAS 51-42-3 Oral Injectable For Asthma & Bronchiectasis from china suppliers

    Brand Name:YIJING

    Model Number:51-42-3

    Place of Origin:SHANGHAI

    Anabolic Steroid Hormones Epinephrine Hydrogen Tartrate CAS 51-42-3 Oral Injectable For Asthma & Bronchiectasis Epinephrine hydrogen tartrate Alias: Epinephrine bitartrate, L-3,4-Dihydroxy-alpha-(methylaminomethyl)benzyl alcohol D-hydrogen bitartrate salt...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Wholesale Polypeptide Hormones GLP - 1 CAS 106612-94-6 For Type 2 Diabetes Mellitus from china suppliers

    Brand Name:YIJING

    Model Number:106612-94-6

    Place of Origin:SHANGHAI

    ​ Polypeptide Hormones GLP-1 CAS 106612-94-6 For Type 2 Diabetes Mellitus 98% Polypeptide Hormones GLP-1 CAS 106612-94-6 Glucagon-Relatedpeptide 1 For The Treatment of Type 2 Diabetes Mellitus Quick Details: GLP-1 (7-37) Acetate Sequence:His-Ala-Glu-Gly...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Wholesale Glucagon Hydrochloride CAS 16941-32-5 For Type 2 Diabetes Mellitus from china suppliers

    Brand Name:YIJING

    Model Number:16941-32-5

    Place of Origin:SHANGHAI

    ​ Glucagon Hydrochloride CAS 16941-32-5 For Type 2 Diabetes Mellitus Quick Details: Product Name: Glucagon Synonyms: GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Wholesale 98% Injectable Polypeptide Hormones AOD9604 CAS 221231-10-3 HGH Fragment 177-191 For Muscle Building & Improving Fat from china suppliers

    Brand Name:YIJING

    Model Number:221231-10-3

    Place of Origin:SHANGHAI

    ...: White Powder Purity : 98% Grade : Pharmaceutical Grade Storage: Closed, below 2 ~ 8℃ preservation Usage : AOD9604 actually acts

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Wholesale Light Yellow Organic Food Ingredients Flaxseed Extract Powder For Digestive Health from china suppliers

    Brand Name:MicroFresh

    Model Number:Powder

    Place of Origin:China

    Flax Seed(Powder/Extract); Organic Food Ingredients, Freeze- Dried; antioxidant factors; Digestive Health Flax (Linum usitatissimum), also known as common flax or linseed, is a member of the genus Linum in the family Linaceae. It is a food and fiber crop ...

    ECA Healthcare Inc
    Active Member

    Shanghai

    Wholesale Dietary Premium Health Supplements Flaxseed Oil Powder Freeze Dried High Omega-3 from china suppliers

    Brand Name:MicroFresh

    Model Number:Powder

    Place of Origin:China

    Flax Seed(Powder/Extract); antioxidant factors; Organic Food Ingredients, Freeze- Dried;Natural origin; high omega-3 Product Overview Flax (Linum usitatissimum), also known as common flax or linseed, is a member of the genus Linum in the family Linaceae. ...

    ECA Healthcare Inc
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0