Sign In | Join Free | My spintoband.com
spintoband.com
Products
Search by Category
Wholesale Marketplace
Home >

Fast Acting Insulins

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    fast acting insulins

    All fast acting insulins wholesalers & fast acting insulins manufacturers come from members. We doesn't provide fast acting insulins products or service, please contact them directly and verify their companies info carefully.

    Total 379 products from fast acting insulins Manufactures & Suppliers
    Wholesale Safe Raw Testosterone Powder Cas 58-22-0 Natural Testosterone Supplements from china suppliers

    Brand Name:Pharma Grade

    Model Number:58-22-0

    Place of Origin:Zhejiang,China

    Natural testosterone supplements Testosterone cas58-22-0 for bodybuilding Quick Details: CAS No.: 58-20-8 EINECS: 200-368-4 Molecular Formula: C27H40O3 Molecular Weight: 412.61 Melting point 98.5-104°C Specific optical rotation +85°-+92° Purity:98% ...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Glibenclamide Tablets Glyburide Tablets 2.5mg, 5mg Oral Medications from china suppliers

    Brand Name:Newlystar

    Place of Origin:China

    Model Number:2.5mg, 5mg

    ... an oral antihyperglycemic agent used for the treatment of non-insulin-dependent diabetes mellitus (NIDDM). It belongs to the sulfonylurea class of insulin secretagogues, which act by stimulating β cells of the pancreas to

    Newlystar (Ningbo) Medtech Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale White powder Cetilistat Used to treat obesity and  type II diabetes from china suppliers

    Brand Name:simmeiquan

    Model Number:winnie@chembj.com

    Place of Origin:china

    ... treat obesity and type II diabetes. Description: Cetilistat is a drug designed to treat obesity. It acts in the same way as the older drug orlistat (Xenical) by inhibiting pancreatic lipase, an...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 from china suppliers

    Brand Name:YIHAN

    Model Number:IGF-1 LR3

    Place of Origin:CHINA

    Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place Grade:Medicine Grad Specification:5mg/...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale Anti - Inflammatory Organic Food Ingredients Ground Flaxseed Powder Halal Approval from china suppliers

    Brand Name:MicroFresh

    Model Number:Powder

    Place of Origin:China

    Flax Seed(Powder/Extract);Freeze- Dried; antioxidant factors; Organic Food Ingredients, Natural origin Flax (Linum usitatissimum), also known as common flax or linseed, is a member of the genus Linum in the family Linaceae. It is a food and fiber crop ...

    ECA Healthcare Inc
    Verified Supplier

    Shanghai

    Wholesale GHRP-6 / GHRP6 Growth Hormone Peptides Lyophilized Powder For Increase muscle CAS:87616-84-0 from china suppliers

    Brand Name:Kafen

    Model Number:87616-84-0

    Place of Origin:China

    GHRP-6 / GHRP6 Growth Hormone Peptides Lyophilized Powder For Increase muscle CAS:87616-84-0 1.Basic info: GHRP-6 CAS: 87616-84-0 M.F.: C46H56N12O6 M.W.: 873.01 Purity : 99.0%min. Appearance: White powder Single Impurity (HPLC): 1.0%max Amino Acid ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale CAS 62031-54-3 Muscle Building Peptides , PEG - MGF Human Growth Hormone For Fat Burning from china suppliers

    Brand Name:Peg Mgf

    Model Number:Peg Mgf

    Place of Origin:China

    ... Fat Burning Abstract PEG-MGF is a gene-spliced version of IGF-1, and quite simply a longer acting form of MGF. PEG-MGF holds up longer in the body and is said to...

    Shandong Chuangrui Chemical Technology Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale Weight Loss Active Pharmaceutical Ingredient API Glipizide CAS 29094-61-9 from china suppliers

    Brand Name:ORI

    Model Number:XALY

    Place of Origin:China

    ... Weight 445.54 Brand Name Sex Enhancers Purity 99% min Uses A hypoglycemic agent that enhances insulin secretion. Character White Crystalline Solid Melting point 208-209°C Standard Enterprise Standard Delivery method EMS...

    Xi'an Oripharm Technology Co.,Ltd
    Verified Supplier

    Shaanxi

    Wholesale Weight Loss Raw Steroid Powders Dehydroepiandrosterone 7-Keto DHEA Metabolism Increase from china suppliers

    Brand Name:Holybiological

    Model Number:566-19-8

    Place of Origin:China

    Weight Loss Raw Steroid Powders Dehydroepiandrosterone 7-Keto DHEA for Metabolism Increase Dehydroepiandrosterone Product name: 7-keto DHEA Synonym: DEHYDROEPIANDROSTERONE, 7-KETO;5-androstene-3b-ol-7,17-dione;5-ANDROSTEN-3-BETA-OL-7,17-DIONE;7-KETO-...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale GHRP-6 5mg 10mg Muscle Building Steroids CAS 87616-84-0 Peptide Hexapeptide from china suppliers

    Brand Name:Keray

    Model Number:87616-84-0

    Place of Origin:China

    GHRP-6 is a peptide in the growth factor family. It has strong effect on the release of Growth Hormone (GH). Buy GHRP-6 of high quality only at Superior Peptide. Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 CAS Registry Number: 87616 Product ...

    Shenzhen Keray Biotech Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Hypoglycemic Medicine Glyburide CAS 10238-21-8 for Mild Diabetes Treatment from china suppliers

    Brand Name:glyburide

    Model Number:pr-2035

    Place of Origin:china

    Hypoglycemic Medicine Glyburide CAS : 10238-21-8 Treatment Of Mild Diabetes Product Name: Glibenclamide Synonyms: 5-CHLORO-N-[2-[4-[[[(CYCLOHEXYLAMINO)CARBONYL]AMINO]SULPHONYL]PHENYL]ETHYL]-2-METHOXYBENZAMIDE;N-P-[2-(5-CHLORO-2-METHOXYBENZAMIDO)ETHYL]...

    Hubei Hongcheng Ming Chemical Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Igtropin IGF-1 Lr3 Oral Human Growth Hormone With Amino Acid Absorption from china suppliers

    Brand Name:SR

    Model Number:94-24-6

    Place of Origin:China

    Igtropin IGF-1 Lr3 0.1mg/vial,10vials/kit,1mg/vial,10vials/kit Purity 99.9% Product Description: 1000mg Injectable Human Growth Hormone Long R3 IGF 1 / IGTROPIN When Igtropin (Long-R3 IGF-1) is lively, Igtropin (Long-R3 IGF-1) works differently in ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale Legal Body Growth IGF1 LR3 Peptide Hormones from china suppliers

    Brand Name:Diselbiotech

    Model Number:IGF-1 LR3

    Place of Origin:China

    ... bodybuilders Growth Basic information: CAS NO. 946870-92-4 Molecular Formula CB6947862 Molecular Weight 9100 Synonyms Insulin-Like Growth Factor-I LR3 IGF-1 is basically a polypeptide hormone that has the same some of...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Oral Sarms Steroids MK - 677 Ibutamoren Bodybuilding CAS 159752-10-0 from china suppliers

    Brand Name:WHYC

    Model Number:MK-677 Ibutamoren CAS 159752-10-0

    Place of Origin:Wuhan,Hubei,China

    CAS 159752-10-0 Sarms MK-677 Ibutamoren for Treating Muscle Wasting Obesity and Osteoporosis Description: Nutrobal (Ibutamoren MK-677, MK-0677, L-163,191)is a potent growth hormone (GH) secretagogue, which mimics GH’s stimulating action of ghrelin – ...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Pharmaceutical Intermediate Peptide IGF-1Lr3 IGF 1mg/vial*10vials 0.1mg*10vials 100iu/kit from china suppliers

    Brand Name:bodybilogical

    Model Number:IGF-1

    Place of Origin:China

    ... Type:API Usage: IGF-1 LR3 is very effective at building muscle and burning fat. It acts as a neuroprotec

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Purity Human Growth Hormone Injections 96827-07-5 for Burns Treatment from china suppliers

    Brand Name:Jiacheng

    Model Number:Human Growth Hormone

    Place of Origin:China

    Purity Human Growth Hormone Injections 96827-07-5 for Burns Treatment Product Details: Kigtropin HGH 10iu/vial, 10vials/kit, 8iu/vial, 25vials/kit CAS: 96827-07-5 Appearance: White Freeze dried Powder Restful sleep (even for insomniacs) Improved mood and ...

    Zhuhai jiacheng Sci. & Tech. Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale 99% Purity CAS 221231-10-3 HGH Frrgment 176-191  Peptide 2mg/Vial for gaining muscles best peptide from china suppliers

    Brand Name:Top Pharm

    Model Number:221231-10-3

    Place of Origin:China

    ...-3 Appearance: White Powder Purity: 98% Grade: Pharmaceutical Grade Storage: Closed, below 2 ~ 8 C preservation Usage: AOD9604 actually acts on the reduction of excessive adipose tissues such as increase in muscle mass, and enhances...

    TOP PHARM CO.,LIMITED
    Verified Supplier

    Wholesale Injection Jintropin 10 Iu HGH Growth Hormone Body Building High Purity Peptide from china suppliers

    Brand Name:FILTER

    Model Number:API

    Place of Origin:China

    Injection Jintropin 10iu for Muscle Building with GMP From Lab (OEM) Product Name:Genotropin (OEM) Specification:10IU,16IU,27IU,36IU Packing:We are for OEM for clients who have Brands requiremtnts. Our company Specialize in Peptides and Steriods.We have ...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Wholesale Mechano Growth Factor Natural Human Growth Hormone , Peptides For Muscle Growth from china suppliers

    Brand Name:YIHAN

    Model Number:MFG (Mechano growthfactor) (I*GF- IEC)

    Place of Origin:CHINA

    ... detail: MGF 2MG - Mechano GrowthFactor Pegylated Mechano GrowthFactor (PEG MGF) is a variant of the I*GF-1 (insulin-like growthfactor-1), which stimulates myoblasts division and allows for muscle fibers to fuse and mature...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Go to Page
    Inquiry Cart 0